Biotechnology Engineering - BT 2015 GATE Paper (Practice Test)


65 Questions MCQ Test GATE Past Year Papers for Practice (All Branches) | Biotechnology Engineering - BT 2015 GATE Paper (Practice Test)


Description
This mock test of Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) for GATE helps you for every GATE entrance exam. This contains 65 Multiple Choice Questions for GATE Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) (mcq) to study with solutions a complete question bank. The solved questions answers in this Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) quiz give you a good mix of easy questions and tough questions. GATE students definitely take this Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) exercise for a better result in the exam. You can find other Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) extra questions, long questions & short questions for GATE on EduRev as well by searching above.
QUESTION: 1

Q.1-5 Carry 1 Mark each

Choose the most appropriate word from the options given below to complete the following sentence.

The principal presented the chief guest with a_________________, as token of appreciation.

Solution:
QUESTION: 2

Choose the appropriate word/pharse, out of the four options given below, to complete the following sentence:

Frogs ____________________.

Solution:
QUESTION: 3

Choose the word most similar in meaning to the given word:

Educe

Solution:
QUESTION: 4

Operators 

Find the value of  

Solution:
QUESTION: 5

If log(5/7)= -1/3, then the value of x is

Solution:
QUESTION: 6

Q.6-10 Carry two Marks each

The following question presents a sentence, part of which is underlined, Beneath the sentence you find four ways of phrsing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. 

Tuberculosis, together with its effects, "rank one of the leading causes of death" in India.

Solution:
QUESTION: 7

Read the following paragarph and choose the correct statement.

Climate change has reduced human security and threated human well being. An ignored reality of  human progress is that human security largely depends upon environmental security. But on the contrary, human progress seems contradicatory to environmentl security. To keep up both at the required level is a challenge to be addressed by one and all. One of the ways to curb the climate change may be suitable scientific innovations, while the other may be the Gandhian perspective on small scale progress with focus on sustainability.

Solution:
*Answer can only contain numeric values
QUESTION: 8

Fill in the missing value.


Solution:
QUESTION: 9

A cube of side 3 units is formed using a set of smaller cubes os side 1 unit. Find the proportion of the number of faces of the smaller cubes visible to those whcih are NOT visible.

Solution:
QUESTION: 10

Humpty Dumpty sits on a well every day while having lunch. The wall sometimes breaks. A person sitting on the wall falls if the wall breaks.

Which one of the statements below is logically valid and can be inferred from the above sentence? 

Solution:
QUESTION: 11

Q. 11 – Q. 35 carry one mark each.
Which one of the following complement proteins is the initiator of the membrane attack complex?

Solution:
QUESTION: 12

Levinthal’s paradox is related to

Solution:
QUESTION: 13

Which one of the following is a second generation genetically engineered crop?

Solution:
QUESTION: 14

Based on the heavy chain, which one of the following antibodies has multiple subtypes?

Solution:
QUESTION: 15

The cytokinetic organelle in plant cells is

Solution:
QUESTION: 16

Anergy refers to

Solution:
QUESTION: 17

ABO blood group antigens in humans are differentiated from each other on the basis of

Solution:
QUESTION: 18

Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant?

Solution:
*Answer can only contain numeric values
QUESTION: 19

A single subunit enzyme converts 420 μmoles of substrate to product in one minute. The activity of the enzyme is ________× 10-6 Katal.


Solution:
QUESTION: 20

Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment?

Solution:
QUESTION: 21

Which one of the following is NOT a product of denitrification in Pseudomonas?

Solution:
*Answer can only contain numeric values
QUESTION: 22

The determinant of the matrix  is ______________.


Solution:
QUESTION: 23

Which one of the following features is NOT required in a prokaryotic expression vector?

Solution:
QUESTION: 24

Production of monoclonal antibodies by hybridoma technology requires

Solution:
QUESTION: 25

Which one of the following is INCORRECT about a typical apoptotic cell?

Solution:
QUESTION: 26

Identify the file format given below:
>P1; JMFD
Protein X – Homo sapiens
MKALTARQQEVFDLIRDHISRTLRQQGDWL

Solution:
QUESTION: 27

Which one of the following relations holds true for the specific growth rate (μ) of a microorganism in the death phase?

Solution:
QUESTION: 28

How many 3-tuples are possible for the following amino acid sequence?
MADCMWDISEASE

Solution:
QUESTION: 29

How many different protein sequences of 100 residues can be generated using 20 standard amino acids?

Solution:
QUESTION: 30

In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be

Solution:
QUESTION: 31

Which one of the following graphs represents uncompetitive inhibition?

Solution:
QUESTION: 32

Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR).
5’-GACCTGTGG-----------------------------ATACGGGAT-3’
3’-CTGGACACC-----------------------------TATGCCCTA-5’

Primers
P. 5’-GACCTGTGG-3’
Q. 5’-CCACAGGTC-3’
R. 5’-TAGGGCATA-3’
S. 5’-ATCCCGTAT-3’

Solution:
*Answer can only contain numeric values
QUESTION: 33

Consider the following infinite series: 1 + r + r2 + r3 + ………. . .∞
If r = 0.3, then the sum of this infinite series is _____________.


Solution:
*Answer can only contain numeric values
QUESTION: 34

2x1 + x2 = 3
5x1 + bx2 = 7.5
The system of linear equations in two variables shown above will have infinite solutions, if and only if, b is equal to ______________.


Solution:
QUESTION: 35

The interaction between an antigen (Ag) and a single-chain antibody (Ab) was studied using Scatchard analysis. The result is shown below.

The affinity of interaction and the total concentration of antibody, respectively, can be determined from

Solution:
*Answer can only contain numeric values
QUESTION: 36

Q. 36 – Q. 65 carry two marks each.

An isolated population on an island has the following genotypic frequencies:

Assuming that there are only two alleles (A and a) for the gene, the genotypic frequency of AA in the next generation will be ______________.


Solution:
QUESTION: 37

How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences?

Solution:
QUESTION: 38

Match the compounds in Group I with the correct entries in Group II.

Solution:
QUESTION: 39

What are the eigenvalues of the following matrix? 

Solution:
*Answer can only contain numeric values
QUESTION: 40

For a discrete random variable x, ran(x) = {0, 1,2,3} and the cumulative probability F(x) is shown below:

 

The mean value of x is ______________.


Solution:
QUESTION: 41

Match the drugs in Group I with their mechanism of action in Group II.

Solution:
QUESTION: 42

The limit of the function  is

Solution:
QUESTION: 43

Match the cells in Group I with their corresponding entries in Group II.

Solution:
*Answer can only contain numeric values
QUESTION: 44

Oxygen transfer was measured in a stirred tank bioreactor using dynamic method. The dissolved oxygen tension was found to be 80% air saturation under steady state conditions. The measured oxygen tensions at 7 s and 17 s were 55% and 68% air saturation, respectively. The volumetric mass transfer coefficient KLa is ____________s-1.


Solution:
QUESTION: 45

Match the microorganisms in Group I with their fermentation products in Group II.

Solution:
*Answer can only contain numeric values
QUESTION: 46

Plasmid DNA (0.5 μg) containing an ampicillin resistance marker was added to 200 μl of competent cells. The transformed competent cells were diluted 10,000 times, out of which, 50 μl was plated on agar plates containing ampicillin. A total of 35 colonies were obtained. The transformation efficiency is ______________× 106 cfu·μg-1.


Solution:
QUESTION: 47

Match the reagents in Group I with their preferred cleavage sites in Group II.

Solution:
*Answer can only contain numeric values
QUESTION: 48

Saccharomyces cerevisiae produces ethanol by fermentation. The theoretical yield of ethanol from 2.5 g of glucose is ______________ g.


Solution:
QUESTION: 49

Choose the CORRECT sequence of steps involved in cytoplast production.

Solution:
QUESTION: 50

Match the antibiotics in Group I with their modes of action in Group II.

Solution:
QUESTION: 51

The diameters of a large and a small vessel are 1.62 m and 16.2 cm, respectively. The vessels are geometrically similar and operated under similar volumetric agitated power input. The mixing time in the small vessel was found to be 15 s. Determine the mixing time (in seconds) in the large vessel.

Solution:
QUESTION: 52

If    then A2 + 3A will be

Solution:
*Answer can only contain numeric values
QUESTION: 53

Consider the following multiple sequence alignment of four DNA sequences.

Shannon’s entropy of the above alignment is ______________.


Solution:
*Answer can only contain numeric values
QUESTION: 54

The Ki of a novel competitive inhibitor designed against an enzyme is 2.5 μM. The enzyme was assayed in the absence or presence of the inhibitor (5 μM) under identical conditions. The Km in the presence of the inhibitor was found to be 30 μM. The Km in the absence of the inhibitor is ______ μM.


Solution:
*Answer can only contain numeric values
QUESTION: 55

A heterozygous tall plant (Tt) was crossed with a homozygous dwarf plant (tt). The resultant seeds were collected. If five seeds are chosen at random, then the probability (in %) that exactly two of these seeds will yield dwarf plants is ______________.


Solution:
*Answer can only contain numeric values
QUESTION: 56

Assuming random distribution of nucleotides, the average number of fragments generated upon digestion of a circular DNA of size 4.3 × 105 bp with AluI (5’-AG↓CT-3’) is _________× 103.


Solution:
*Answer can only contain numeric values
QUESTION: 57

A synchronous culture containing 1.8 × 105 monkey kidney cells was seeded into three identical flasks. The doubling time of these cells is 24 h. After 24 h, the cells from all the three flasks were pooled and dispensed equally into each well of three 6-well plates. The number of cells in each well will be _____________× 104.


Solution:
QUESTION: 58

An in vitro translation system can synthesize peptides in all three reading frames of the RNA template. When 5’- UCUCUCUC----(UC)n---UCUCUCUC - 3’ was used as the template in this in vitro translation system, the synthesized peptides contained 50% each of serine and leucine. When 5’- CCUCCUCCU---(CCU)n--CCUCCU - 3’ was used as the template, the synthesized peptides contained 33.3% each of serine, leucine, and proline. Deduce the codon for proline.

Solution:
QUESTION: 59

Three distinct antigens X, Y and Z were used to raise antibodies. Antigen Z was injected in a mouse on day zero followed by the administration of antigens X and Y on day 28. A second injection of antigen X was administered on day 70. The antibody titers were monitored in the serum every day and the results are shown below:

Which one of the following statements regarding the antibody titers in the serum is INCORRECT?

Solution:
*Answer can only contain numeric values
QUESTION: 60

The standard free energy change (ΔG′°) for ATP hydrolysis is −30 kJ·mole-1. The in vivo concentrations of ATP, ADP and Pi in E. coli are 7.90, 1.04 and 7.90 mM, respectively. When E. coli cells are cultured at 37 ºC, the free energy change (ΔG) for ATP hydrolysis in vivo is _________ kJ·mole-1.


Solution:
QUESTION: 61

In a fed-batch culture, 200 g · L-1 glucose solution is added at a flow rate of 50 L·h-1. The initial culture volume (at quasi steady state) and the initial cell concentration are 600 L and 20 g · L-1, respectively. The yield coefficient (Yx/s) is 0.5 g cell mass·g substrate-1. The cell concentration (g · L-1) at quasi steady state at t=8 h is

Solution:
QUESTION: 62

Cytoplasmic extract from the wild type strain of a bacterium has the ability to convert a colorless substrate (S) to a colored product (P) via three colorless intermediates X, Y and Z, in that order. Each step of the pathway involves a specific enzyme coded by a distinct gene. Four mutant strains (a-, b-, c-, d-) were isolated, whose extracts are incapable of producing the colored product in the presence of S. In a series of experiments, extracts from the individual mutants were incubated with X, Y, or Z and scored for color development. The data are summarized in the table below. (Yes: color developed, No: no color developed)

Based on the data, which one of the following is the correct order of enzymes involved in the pathway?

Solution:
*Answer can only contain numeric values
QUESTION: 63

Samples of bacterial culture taken at 5 PM and then the next day at 5 AM were found to have 104 and 107 cells·mL-1, respectively. Assuming that both the samples were taken during the log phase of cell growth, the generation time of this bacterium will be ______________h.


Solution:
QUESTION: 64

Biomass is being produced in a continuous stirred tank bioreactor of 750 L capacity. The sterile feed containing 8 g · L-1 glucose as substrate was fed at a flow rate of 150 L · h-1. The microbial system follows Monod’s model with μm = 0.4 h-1 , Ks = 1.5 g · L-1 and Yx/s = 0.5 g cell mass·g substrate-1. Determine the cell productivity (g · L-1 · h-1) at steady state.

Solution:
QUESTION: 65

A linear double stranded DNA of length 8 kbp has three restriction sites. Each of these can either be a BamHI or a HaeIII site. The DNA was digested completely with both enzymes. The products were purified and subjected to an end-filling reaction using the Klenow fragment and [α-32P]-dCTP. The products of the end-filling reaction were purified, resolved by electrophoresis, stained with ethidium bromide (EtBr) and then subjected to autoradiography. The corresponding images are shown below.

The numbers below each band in the sample lane in the autoradiograph represent their mean signal intensity in arbitrary units. Which one of the following options is the correct restriction map of the DNA?

Solution: