Biotechnology Engineering - BT 2015 GATE Paper (Practice Test) - GATE MCQ

Operators 

Find the value of  

If log_x (5/7)= -1/3, then the value of x is

Q.6-10 Carry two Marks each

The following question presents a sentence, part of which is underlined, Beneath the sentence you find four ways of phrsing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. 

Tuberculosis, together with its effects, "rank one of the leading causes of death" in India.

Read the following paragarph and choose the correct statement.

Climate change has reduced human security and threated human well being. An ignored reality of  human progress is that human security largely depends upon environmental security. But on the contrary, human progress seems contradicatory to environmentl security. To keep up both at the required level is a challenge to be addressed by one and all. One of the ways to curb the climate change may be suitable scientific innovations, while the other may be the Gandhian perspective on small scale progress with focus on sustainability.

Fill in the missing value.

A cube of side 3 units is formed using a set of smaller cubes os side 1 unit. Find the proportion of the number of faces of the smaller cubes visible to those whcih are NOT visible.

Humpty Dumpty sits on a well every day while having lunch. The wall sometimes breaks. A person sitting on the wall falls if the wall breaks.

Which one of the statements below is logically valid and can be inferred from the above sentence? 

Q. 11 – Q. 35 carry one mark each.
Which one of the following complement proteins is the initiator of the membrane attack complex?

Levinthal’s paradox is related to

Which one of the following is a second generation genetically engineered crop?

Based on the heavy chain, which one of the following antibodies has multiple subtypes?

The cytokinetic organelle in plant cells is

Anergy refers to

ABO blood group antigens in humans are differentiated from each other on the basis of

Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant?

A single subunit enzyme converts 420 μmoles of substrate to product in one minute. The activity of the enzyme is ________× 10^-6 Katal.

Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment?

Which one of the following is NOT a product of denitrification in Pseudomonas?

The determinant of the matrix  is ______________.

Which one of the following features is NOT required in a prokaryotic expression vector?

Production of monoclonal antibodies by hybridoma technology requires

Which one of the following is INCORRECT about a typical apoptotic cell?

Identify the file format given below:
>P1; JMFD
Protein X – Homo sapiens
MKALTARQQEVFDLIRDHISRTLRQQGDWL

Which one of the following relations holds true for the specific growth rate (μ) of a microorganism in the death phase?

How many 3-tuples are possible for the following amino acid sequence?
MADCMWDISEASE

How many different protein sequences of 100 residues can be generated using 20 standard amino acids?

In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be